PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf05410g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 326aa    MW: 37232.2 Da    PI: 4.6048
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf05410g00029.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.4e-29271321151
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                               krien + rqvtfskRr g+lKKA+ELSvLCdaev++iifs++gklye+ss
  Peinf101Scf05410g00029.1 271 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVSLIIFSTKGKLYEFSS 321
                               79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637263323IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-39263322IPR002100Transcription factor, MADS-box
PROSITE patternPS003500265319IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-30265285IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-27265323IPR002100Transcription factor, MADS-box
CDDcd002655.28E-34265322No hitNo description
PfamPF003191.1E-24272319IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-30285300IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-30300321IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MIAAWGDTSD EESEYEDERD DLALMAKSDS ESDDEFSERE NKRQSYLSSQ SQTHTKETIT  60
LKLKKHCCGR FGQHLKKEID EEDSIENKTN NSEDFDEIGD DTKALIEGEF LSVDGTHISG  120
HISAKEVNHF TRTIACTSVC EMVPEKLREI EGYESKGEGS DAIENYENSE RLMSVEEESE  180
NENLSNVERE ECNEFSMPVG GRKGNKRPYV VDPSSSRASD DEIAVLKMEI VELRDENAIQ  240
RDLLFRLNDK FEEAKTKLSR RRMVRGKTQI KRIENATSRQ VTFSKRRSGL LKKAFELSVL  300
CDAEVSLIIF STKGKLYEFS SSRLVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-16265322259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16265322259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16265322259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-16265322259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-16265322259Myocyte-specific enhancer factor 2A
3p57_I2e-16265322259Myocyte-specific enhancer factor 2A
3p57_D2e-16265322259Myocyte-specific enhancer factor 2A
3p57_C2e-16265322259Myocyte-specific enhancer factor 2A
3p57_B2e-16265322259Myocyte-specific enhancer factor 2A
3p57_A2e-16265322259Myocyte-specific enhancer factor 2A
3kov_J2e-16265322259Myocyte-specific enhancer factor 2A
3kov_I2e-16265322259Myocyte-specific enhancer factor 2A
3kov_B2e-16265322259Myocyte-specific enhancer factor 2A
3kov_A2e-16265322259Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3705221e-79AY370522.1 Petunia x hybrida MADS-box protein 10 (PMADS10) gene, partial cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-32AGAMOUS-like 20